![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein automated matches [190118] (16 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries) |
![]() | Domain d2w9na1: 2w9n A:1-76 [244066] automated match to d4auqc_ complexed with cl, zn |
PDB Entry: 2w9n (more details), 2.25 Å
SCOPe Domain Sequences for d2w9na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w9na1 d.15.1.1 (A:1-76) automated matches {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d2w9na1: