SCOPe 2.08: Domain d2w93a2: 2w93 A:182-360

Lineage for d2w93a2 (2w93 A:182-360)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.0: automated matches [191352] (1 protein)
   not a true family

6. Protein automated matches [190312] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255616] (4 PDB entries)

8. Domain d2w93a2: 2w93 A:182-360 [244052]
   Other proteins in same PDB: d2w93a1, d2w93a3, d2w93b1, d2w93b3, d2w93c1, d2w93c3, d2w93d1, d2w93d3
   automated match to d1qpba1
   complexed with mg, py0, tpp

Details for d2w93a2

PDB Entry: 2w93, 1.6 Å

PDB Description: crystal structure of the saccharomyces cerevisiae pyruvate decarboxylase variant e477q in complex with the surrogate pyruvamide

PDB Compounds: (A:) pyruvate decarboxylase isozyme 1

SCOPe Domain Sequences for d2w93a2:

Sequence, based on SEQRES records:

>d2w93a2 c.31.1.0 (A:182-360) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfp
afvtpmgkgsideqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsysy
ktknivefhsdhmkirnatfpgvqmkfvlqklltniadaakgykpvavpartpanaavp

Sequence, based on observed residues (ATOM records):

>d2w93a2 c.31.1.0 (A:182-360) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfp
afvtpmgkgsideqhpryggvyvgtlskpevkeavesadlilsvgaltknivefhsdhmk
irnatfpgvqmkfvlqklltniadaakgykpvavpartpanaavp

Timeline for d2w93a2:

• d2w93a2 first appeared in SCOPe 2.04
  
• d2w93a2 appears in SCOPe 2.07