Lineage for d1d6ub1 (1d6u B:301-725)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781475Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 2781476Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins)
  6. 2781477Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 2781543Species Escherichia coli [TaxId:562] [50001] (16 PDB entries)
  8. 2781573Domain d1d6ub1: 1d6u B:301-725 [24403]
    Other proteins in same PDB: d1d6ua2, d1d6ua3, d1d6ua4, d1d6ub2, d1d6ub3, d1d6ub4
    complexed with ca, cu, gol, hy1, pea

Details for d1d6ub1

PDB Entry: 1d6u (more details), 2.4 Å

PDB Description: crystal structure of e. coli amine oxidase anaerobically reduced with beta-phenylethylamine
PDB Compounds: (B:) copper amine oxidase

SCOPe Domain Sequences for d1d6ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ub1 b.30.2.1 (B:301-725) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galkk

SCOPe Domain Coordinates for d1d6ub1:

Click to download the PDB-style file with coordinates for d1d6ub1.
(The format of our PDB-style files is described here.)

Timeline for d1d6ub1: