SCOPe 2.05: Domain d2w69d_: 2w69 D:

Lineage for d2w69d_ (2w69 D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein automated matches [254637] (1 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [255640] (1 PDB entry)

8. Domain d2w69d_: 2w69 D: [244029]
   automated match to d3ebja_
   complexed with mn, so4

Details for d2w69d_

PDB Entry: 2w69, 2.05 Å

PDB Description: influenza polymerase fragment

PDB Compounds: (D:) Polymerase acidic protein

SCOPe Domain Sequences for d2w69d_:

Sequence, based on SEQRES records:

>d2w69d_ c.52.1.34 (D:) automated matches {Influenza A virus [TaxId: 11320]}
amedfvrqcfnpmivelaekamkeygedlkietnkfaaicthlevcfmysdfhfineqge
sivvelddpnallkhrfeiiegrdrtmawtvvnsicnttgaekpkflpdlydykenrfie
igvtrrevhiyylekankiksenthihifsftgeematkadytldeesrariktrlftir
qemanrglwdsfrqser

Sequence, based on observed residues (ATOM records):

>d2w69d_ c.52.1.34 (D:) automated matches {Influenza A virus [TaxId: 11320]}
amedfvrqcfnpmivelaekamkeygedlkietnkfaaicthlevcfmysdfhfineqge
sivhrfeiiegrdrtmawtvvnsicnttgaekpkflpdlydykenrfieigvtrrevhiy
ylekankikthihifsftgeematkadytldeesrariktrlftirqemanrglwdsfrq
ser

Timeline for d2w69d_:

• d2w69d_ first appeared in SCOPe 2.04
  
• d2w69d_ is called d2w69d1 in SCOPe 2.06
  
• d2w69d_ appears in the current release, SCOPe 2.08, called d2w69d1