Lineage for d2w69d_ (2w69 D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856505Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1856506Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1856940Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 1857018Protein automated matches [254637] (1 species)
    not a true protein
  7. 1857019Species Influenza A virus [TaxId:11320] [255640] (1 PDB entry)
  8. 1857022Domain d2w69d_: 2w69 D: [244029]
    automated match to d3ebja_
    complexed with mn, so4

Details for d2w69d_

PDB Entry: 2w69 (more details), 2.05 Å

PDB Description: influenza polymerase fragment
PDB Compounds: (D:) Polymerase acidic protein

SCOPe Domain Sequences for d2w69d_:

Sequence, based on SEQRES records: (download)

>d2w69d_ c.52.1.34 (D:) automated matches {Influenza A virus [TaxId: 11320]}
amedfvrqcfnpmivelaekamkeygedlkietnkfaaicthlevcfmysdfhfineqge
sivvelddpnallkhrfeiiegrdrtmawtvvnsicnttgaekpkflpdlydykenrfie
igvtrrevhiyylekankiksenthihifsftgeematkadytldeesrariktrlftir
qemanrglwdsfrqser

Sequence, based on observed residues (ATOM records): (download)

>d2w69d_ c.52.1.34 (D:) automated matches {Influenza A virus [TaxId: 11320]}
amedfvrqcfnpmivelaekamkeygedlkietnkfaaicthlevcfmysdfhfineqge
sivhrfeiiegrdrtmawtvvnsicnttgaekpkflpdlydykenrfieigvtrrevhiy
ylekankikthihifsftgeematkadytldeesrariktrlftirqemanrglwdsfrq
ser

SCOPe Domain Coordinates for d2w69d_:

Click to download the PDB-style file with coordinates for d2w69d_.
(The format of our PDB-style files is described here.)

Timeline for d2w69d_: