SCOPe 2.08: Domain d2w69b1: 2w69 B:1-196

Lineage for d2w69b1 (2w69 B:1-196)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (3 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein automated matches [254637] (1 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [255640] (2 PDB entries)

8. Domain d2w69b1: 2w69 B:1-196 [244028]
   Other proteins in same PDB: d2w69a2, d2w69b2, d2w69d2
   automated match to d3ebja_
   complexed with mn, so4

Details for d2w69b1

PDB Entry: 2w69, 2.05 Å

PDB Description: influenza polymerase fragment

PDB Compounds: (B:) Polymerase acidic protein

SCOPe Domain Sequences for d2w69b1:

Sequence; same for both SEQRES and ATOM records:

>d2w69b1 c.52.1.34 (B:1-196) automated matches {Influenza A virus, different strains [TaxId: 11320]}
medfvrqcfnpmivelaekamkeygedlkietnkfaaicthlevcfmysdfhfineqges
ivvelddpnallkhrfeiiegrdrtmawtvvnsicnttgaekpkflpdlydykenrfiei
gvtrrevhiyylekankiksenthihifsftgeematkadytldeesrariktrlftirq
emanrglwdsfrqser

Timeline for d2w69b1:

• d2w69b1 first appeared in SCOPe 2.04, called d2w69b_
  
• d2w69b1 appears in SCOPe 2.07