Lineage for d2w69a1 (2w69 A:1-196)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882703Family c.52.1.34: PA N-terminal domain [254166] (3 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 2882884Protein automated matches [254637] (1 species)
    not a true protein
  7. 2882885Species Influenza A virus, different strains [TaxId:11320] [255640] (2 PDB entries)
  8. 2882886Domain d2w69a1: 2w69 A:1-196 [244027]
    Other proteins in same PDB: d2w69a2, d2w69b2, d2w69d2
    automated match to d3ebja_
    complexed with mn, so4

Details for d2w69a1

PDB Entry: 2w69 (more details), 2.05 Å

PDB Description: influenza polymerase fragment
PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d2w69a1:

Sequence, based on SEQRES records: (download)

>d2w69a1 c.52.1.34 (A:1-196) automated matches {Influenza A virus, different strains [TaxId: 11320]}
medfvrqcfnpmivelaekamkeygedlkietnkfaaicthlevcfmysdfhfineqges
ivvelddpnallkhrfeiiegrdrtmawtvvnsicnttgaekpkflpdlydykenrfiei
gvtrrevhiyylekankiksenthihifsftgeematkadytldeesrariktrlftirq
emanrglwdsfrqser

Sequence, based on observed residues (ATOM records): (download)

>d2w69a1 c.52.1.34 (A:1-196) automated matches {Influenza A virus, different strains [TaxId: 11320]}
medfvrqcfnpmivelaekamkeygedlkietnkfaaicthlevcfmysdfhfineqges
ivvelddpnalkhrfeiiegrdrtmawtvvnsicnttgaekpkflpdlydykenrfieig
vtrrevhiyylekankiksthihifsftgeematkadytldeesrariktrlftirqema
nrglwdsfrqser

SCOPe Domain Coordinates for d2w69a1:

Click to download the PDB-style file with coordinates for d2w69a1.
(The format of our PDB-style files is described here.)

Timeline for d2w69a1: