SCOPe 2.04: Domain d2w4rc_: 2w4r C:

Lineage for d2w4rc_ (2w4r C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.88: Mss4-like [51315] (2 superfamilies)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.2: RIG-I C-terminal-like [254142] (2 families)
   Pfam PF11648

5. Family b.88.2.1: RIG-I C-terminal domain-like [254188] (4 proteins)

6. Protein automated matches [254636] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255639] (2 PDB entries)

8. Domain d2w4rc_: 2w4r C: [244025]
   automated match to d2rqaa_
   complexed with hg, so4

Details for d2w4rc_

PDB Entry: 2w4r, 2.6 Å

PDB Description: crystal structure of the regulatory domain of human lgp2

PDB Compounds: (C:) probable ATP-dependent RNA helicase dhx58

SCOPe Domain Sequences for d2w4rc_:

Sequence, based on SEQRES records:

>d2w4rc_ b.88.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrqqfpvehvqllcincmvavghgsdlrkvegthhvnvnpnfsnyynvsrdpvvinkvfk
dwkpggviscrncgevwglqmiyksvklpvlkvrsmlletpqgriqakkwsrvpfsvpdf
dflqhcaenl

Sequence, based on observed residues (ATOM records):

>d2w4rc_ b.88.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrqqfpvehvqllcincmvavghgsdlrkvegthhvnvnpnfsnyynvsrdvfkdwkpgg
viscrncgevwglqmiyksvklpvlkvrsmlletpqgriqakkwsrvpfsvpdfdflqhc
aenl

Timeline for d2w4rc_:

• d2w4rc_ is new in SCOPe 2.04-stable
  
• d2w4rc_ appears in SCOPe 2.05
  
• d2w4rc_ appears in the current release, SCOPe 2.08