Lineage for d2w2qa_ (2w2q A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114950Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2114951Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2115291Family c.41.1.0: automated matches [191390] (1 protein)
    not a true family
  6. 2115292Protein automated matches [190500] (8 species)
    not a true protein
  7. 2115293Species Human (Homo sapiens) [TaxId:9606] [255634] (7 PDB entries)
  8. 2115295Domain d2w2qa_: 2w2q A: [244021]
    Other proteins in same PDB: d2w2qe1, d2w2qe2
    automated match to d1s2nb_
    complexed with ca; mutant

Details for d2w2qa_

PDB Entry: 2w2q (more details), 2.33 Å

PDB Description: pcsk9-deltac d374h mutant bound to wt egf-a of ldlr
PDB Compounds: (A:) Proprotein convertase subtilisin/kexin type 9

SCOPe Domain Sequences for d2w2qa_:

Sequence, based on SEQRES records: (download)

>d2w2qa_ c.41.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sipwnleritppryradeyqppdggslvevylldtsiqsdhreiegrvmvtdfenvpeed
gtrfhrqaskcdshgthlagvvsgrdagvakgasmrslrvlncqgkgtvsgtliglefir
ksqlvqpvgplvvllplaggysrvlnaacqrlaragvvlvtaagnfrddaclyspasape
vitvgatnaqdqpvtlgtlgtnfgrcvdlfapgediigasshcstcfvsqsgtsqaaahv
agiaammlsaepeltlaelrqrlihfsakdvineawfpedqrvltpnlvaalpps

Sequence, based on observed residues (ATOM records): (download)

>d2w2qa_ c.41.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sipwnleritpprslvevylldtsiqsdhreiegrvmvtdfenvpeedskcdshgthlag
vvsgrdagvakgasmrslrvlncqgkgtvsgtliglefirksqlvqpvgplvvllplagg
ysrvlnaacqrlaragvvlvtaagnfrddaclyspasapevitvgatnaqdqpvtlgtlg
tnfgrcvdlfapgediigasshcstcfvsqsgtsqaaahvagiaammlsaepeltlaelr
qrlihfsakdvineawfpedqrvltpnlvaalpps

SCOPe Domain Coordinates for d2w2qa_:

Click to download the PDB-style file with coordinates for d2w2qa_.
(The format of our PDB-style files is described here.)

Timeline for d2w2qa_: