Lineage for d2w2oe1 (2w2o E:293-332)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031827Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 3031828Protein automated matches [226968] (5 species)
    not a true protein
  7. 3031829Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries)
  8. 3031857Domain d2w2oe1: 2w2o E:293-332 [244018]
    Other proteins in same PDB: d2w2oa_, d2w2oe2
    automated match to d3bpse1
    complexed with ca; mutant

Details for d2w2oe1

PDB Entry: 2w2o (more details), 2.62 Å

PDB Description: pcsk9-deltac d374y mutant bound to wt egf-a of ldlr
PDB Compounds: (E:) low-density lipoprotein receptor

SCOPe Domain Sequences for d2w2oe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w2oe1 g.3.11.0 (E:293-332) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrce

SCOPe Domain Coordinates for d2w2oe1:

Click to download the PDB-style file with coordinates for d2w2oe1.
(The format of our PDB-style files is described here.)

Timeline for d2w2oe1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2w2oe2
View in 3D
Domains from other chains:
(mouse over for more information)
d2w2oa_