SCOPe 2.07: Domain d2w2me1: 2w2m E:293-333

Lineage for d2w2me1 (2w2m E:293-333)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.0: automated matches [227227] (1 protein)
   not a true family

6. Protein automated matches [226968] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries)

8. Domain d2w2me1: 2w2m E:293-333 [244014]
   Other proteins in same PDB: d2w2ma_, d2w2me2
   automated match to d3bpse1
   complexed with ca

Details for d2w2me1

PDB Entry: 2w2m, 2.4 Å

PDB Description: wt pcsk9-deltac bound to wt egf-a of ldlr

PDB Compounds: (E:) low-density lipoprotein receptor

SCOPe Domain Sequences for d2w2me1:

Sequence; same for both SEQRES and ATOM records:

>d2w2me1 g.3.11.0 (E:293-333) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrced

Timeline for d2w2me1:

• d2w2me1 first appeared in SCOPe 2.04, called d2w2me_
  
• d2w2me1 appears in SCOPe 2.06
  
• d2w2me1 appears in the current release, SCOPe 2.08