| Class g: Small proteins [56992] (100 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
| Protein automated matches [226968] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries) |
| Domain d2w2me1: 2w2m E:293-333 [244014] Other proteins in same PDB: d2w2ma_, d2w2me2 automated match to d3bpse1 complexed with ca |
PDB Entry: 2w2m (more details), 2.4 Å
SCOPe Domain Sequences for d2w2me1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w2me1 g.3.11.0 (E:293-333) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrced
Timeline for d2w2me1: