Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.0: automated matches [191551] (1 protein) not a true family |
Protein automated matches [190951] (21 species) not a true protein |
Species Haemophilus influenzae [TaxId:727] [231294] (14 PDB entries) |
Domain d2w0wa1: 2w0w A:4-251 [244008] Other proteins in same PDB: d2w0wa2 automated match to d2v0la1 complexed with lzs, pg4 |
PDB Entry: 2w0w (more details), 2.59 Å
SCOPe Domain Sequences for d2w0wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w0wa1 c.68.1.0 (A:4-251) automated matches {Haemophilus influenzae [TaxId: 727]} kalsavilaagkgtrmysdlpkvlhtiagkpmvkhvidtahqlgsenihliyghggdlmr thlaneqvnwvlqteqlgtahavqqaapffkdnenivvlygdaplitketleklieakpe ngialltvnldnptgygriirengnvvaiveqkdanaeqlnikevntgvmvsdgasfkkw larvgnnnaqgeyyltdlialanqdncqvvavqatdvmevegannrlqlaaleryfqnkq askllleg
Timeline for d2w0wa1: