SCOPe 2.06: Domain d2w0va1: 2w0v A:4-251

Lineage for d2w0va1 (2w0v A:4-251)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.0: automated matches [191551] (1 protein)
   not a true family

6. Protein automated matches [190951] (26 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:727] [231294] (14 PDB entries)

8. Domain d2w0va1: 2w0v A:4-251 [244006]
   Other proteins in same PDB: d2w0va2
   automated match to d2v0la1
   complexed with lzr, pg4, pge, so4

Details for d2w0va1

PDB Entry: 2w0v, 1.99 Å

PDB Description: crystal structure of glmu from haemophilus influenzae in complex with quinazoline inhibitor 1

PDB Compounds: (A:) glucosamine-1-phosphate n-acetyltransferase

SCOPe Domain Sequences for d2w0va1:

Sequence; same for both SEQRES and ATOM records:

>d2w0va1 c.68.1.0 (A:4-251) automated matches {Haemophilus influenzae [TaxId: 727]}
kalsavilaagkgtrmysdlpkvlhtiagkpmvkhvidtahqlgsenihliyghggdlmr
thlaneqvnwvlqteqlgtahavqqaapffkdnenivvlygdaplitketleklieakpe
ngialltvnldnptgygriirengnvvaiveqkdanaeqlnikevntgvmvsdgasfkkw
larvgnnnaqgeyyltdlialanqdncqvvavqatdvmevegannrlqlaaleryfqnkq
askllleg

Timeline for d2w0va1:

• d2w0va1 first appeared in SCOPe 2.04
  
• d2w0va1 appears in SCOPe 2.05
  
• d2w0va1 appears in SCOPe 2.07
  
• d2w0va1 appears in the current release, SCOPe 2.08