Lineage for d2vzvb4 (2vzv B:675-777)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2762930Species Amycolatopsis orientalis [TaxId:31958] [255630] (4 PDB entries)
  8. 2762953Domain d2vzvb4: 2vzv B:675-777 [244004]
    Other proteins in same PDB: d2vzva1, d2vzva3, d2vzvb1, d2vzvb3
    automated match to d2vzsa3

Details for d2vzvb4

PDB Entry: 2vzv (more details), 2.7 Å

PDB Description: substrate complex of amycolatopsis orientalis exo-chitosanase csxa e541a with chitosan
PDB Compounds: (B:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2vzvb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vzvb4 b.1.4.0 (B:675-777) automated matches {Amycolatopsis orientalis [TaxId: 31958]}
plhiqyshdnrsvvvinqtsnavsgltattklynldgtekysntktglsvgalgakatav
tvpavsglsttylaknvltdssgkevsrnvywlstkadtlnwg

SCOPe Domain Coordinates for d2vzvb4:

Click to download the PDB-style file with coordinates for d2vzvb4.
(The format of our PDB-style files is described here.)

Timeline for d2vzvb4: