| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
| Protein automated matches [254633] (19 species) not a true protein |
| Species Amycolatopsis orientalis [TaxId:31958] [255630] (4 PDB entries) |
| Domain d2vzva4: 2vzv A:675-777 [243999] Other proteins in same PDB: d2vzva1, d2vzva3, d2vzvb1, d2vzvb3 automated match to d2vzsa3 |
PDB Entry: 2vzv (more details), 2.7 Å
SCOPe Domain Sequences for d2vzva4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vzva4 b.1.4.0 (A:675-777) automated matches {Amycolatopsis orientalis [TaxId: 31958]}
plhiqyshdnrsvvvinqtsnavsgltattklynldgtekysntktglsvgalgakatav
tvpavsglsttylaknvltdssgkevsrnvywlstkadtlnwg
Timeline for d2vzva4: