Lineage for d2vzva1 (2vzv A:42-225)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384655Species Amycolatopsis orientalis [TaxId:31958] [255629] (4 PDB entries)
  8. 2384662Domain d2vzva1: 2vzv A:42-225 [243996]
    Other proteins in same PDB: d2vzva2, d2vzva3, d2vzva4, d2vzva5, d2vzvb2, d2vzvb3, d2vzvb4, d2vzvb5
    automated match to d2vzsa4

Details for d2vzva1

PDB Entry: 2vzv (more details), 2.7 Å

PDB Description: substrate complex of amycolatopsis orientalis exo-chitosanase csxa e541a with chitosan
PDB Compounds: (A:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2vzva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vzva1 b.18.1.0 (A:42-225) automated matches {Amycolatopsis orientalis [TaxId: 31958]}
lsvgaaagnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkya
dpfystnmqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdq
vngaytrhdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlv
rrsg

SCOPe Domain Coordinates for d2vzva1:

Click to download the PDB-style file with coordinates for d2vzva1.
(The format of our PDB-style files is described here.)

Timeline for d2vzva1: