Class b: All beta proteins [48724] (178 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (49 species) not a true protein |
Species Amycolatopsis orientalis [TaxId:31958] [255629] (4 PDB entries) |
Domain d2vzva1: 2vzv A:42-225 [243996] Other proteins in same PDB: d2vzva2, d2vzva3, d2vzva4, d2vzva5, d2vzvb2, d2vzvb3, d2vzvb4, d2vzvb5 automated match to d2vzsa4 |
PDB Entry: 2vzv (more details), 2.7 Å
SCOPe Domain Sequences for d2vzva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vzva1 b.18.1.0 (A:42-225) automated matches {Amycolatopsis orientalis [TaxId: 31958]} lsvgaaagnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkya dpfystnmqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdq vngaytrhdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlv rrsg
Timeline for d2vzva1: