Lineage for d2vzub5 (2vzu B:778-899)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2762930Species Amycolatopsis orientalis [TaxId:31958] [255630] (4 PDB entries)
  8. 2762942Domain d2vzub5: 2vzu B:778-899 [243995]
    Other proteins in same PDB: d2vzua1, d2vzua3, d2vzub1, d2vzub3
    automated match to d2vzsa2
    complexed with act, cd, pnj

Details for d2vzub5

PDB Entry: 2vzu (more details), 2.1 Å

PDB Description: complex of amycolatopsis orientalis exo-chitosanase csxa d469a with pnp-beta-d-glucosamine
PDB Compounds: (B:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2vzub5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vzub5 b.1.4.0 (B:778-899) automated matches {Amycolatopsis orientalis [TaxId: 31958]}
gsdwyytpqsafadlsglnnlgqsavgatansvagadgtttttvtlkntsggrlpafyvd
skvvdsagkpvlpvewnanavslwpgetttltakyrtadlkgskpsvrisgwntgtqtvp
ad

SCOPe Domain Coordinates for d2vzub5:

Click to download the PDB-style file with coordinates for d2vzub5.
(The format of our PDB-style files is described here.)

Timeline for d2vzub5: