![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) ![]() automatically mapped to Pfam PF01179 |
![]() | Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins) |
![]() | Protein Copper amine oxidase, domain 3 [50000] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [50001] (16 PDB entries) |
![]() | Domain d1spub1: 1spu B:301-725 [24399] Other proteins in same PDB: d1spua2, d1spua3, d1spua4, d1spub2, d1spub3, d1spub4 complexed with ca, cu |
PDB Entry: 1spu (more details), 2 Å
SCOPe Domain Sequences for d1spub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1spub1 b.30.2.1 (B:301-725) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]} pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl galkk
Timeline for d1spub1:
![]() Domains from other chains: (mouse over for more information) d1spua1, d1spua2, d1spua3, d1spua4 |