Lineage for d2vzua1 (2vzu A:49-225)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777799Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1777800Protein automated matches [190770] (31 species)
    not a true protein
  7. 1777801Species Amycolatopsis orientalis [TaxId:31958] [255629] (4 PDB entries)
  8. 1777802Domain d2vzua1: 2vzu A:49-225 [243986]
    Other proteins in same PDB: d2vzua2, d2vzua3, d2vzua4, d2vzua5, d2vzub2, d2vzub3, d2vzub4, d2vzub5
    automated match to d2vzsa4
    complexed with act, cd, pnj

Details for d2vzua1

PDB Entry: 2vzu (more details), 2.1 Å

PDB Description: complex of amycolatopsis orientalis exo-chitosanase csxa d469a with pnp-beta-d-glucosamine
PDB Compounds: (A:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2vzua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vzua1 b.18.1.0 (A:49-225) automated matches {Amycolatopsis orientalis [TaxId: 31958]}
gnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfystn
mqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngaytr
hdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsg

SCOPe Domain Coordinates for d2vzua1:

Click to download the PDB-style file with coordinates for d2vzua1.
(The format of our PDB-style files is described here.)

Timeline for d2vzua1: