![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Amycolatopsis orientalis [TaxId:31958] [255629] (4 PDB entries) |
![]() | Domain d2vzua1: 2vzu A:49-225 [243986] Other proteins in same PDB: d2vzua2, d2vzua3, d2vzua4, d2vzua5, d2vzub2, d2vzub3, d2vzub4, d2vzub5 automated match to d2vzsa4 complexed with act, cd, pnj |
PDB Entry: 2vzu (more details), 2.1 Å
SCOPe Domain Sequences for d2vzua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vzua1 b.18.1.0 (A:49-225) automated matches {Amycolatopsis orientalis [TaxId: 31958]} gnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfystn mqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngaytr hdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsg
Timeline for d2vzua1: