Lineage for d2vztb1 (2vzt B:49-225)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2047120Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2047121Protein automated matches [190770] (37 species)
    not a true protein
  7. 2047122Species Amycolatopsis orientalis [TaxId:31958] [255629] (4 PDB entries)
  8. 2047126Domain d2vztb1: 2vzt B:49-225 [243981]
    Other proteins in same PDB: d2vzta2, d2vzta3, d2vzta4, d2vzta5, d2vztb2, d2vztb3, d2vztb4, d2vztb5
    automated match to d2vzsa4
    complexed with act, cd, pnj

Details for d2vztb1

PDB Entry: 2vzt (more details), 2.2 Å

PDB Description: complex of amycolatopsis orientalis exo-chitosanase csxa e541a with pnp-beta-d-glucosamine
PDB Compounds: (B:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2vztb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vztb1 b.18.1.0 (B:49-225) automated matches {Amycolatopsis orientalis [TaxId: 31958]}
gnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfystn
mqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngaytr
hdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsg

SCOPe Domain Coordinates for d2vztb1:

Click to download the PDB-style file with coordinates for d2vztb1.
(The format of our PDB-style files is described here.)

Timeline for d2vztb1: