Lineage for d2vzta2 (2vzt A:226-335)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2372434Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2372926Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2372927Protein automated matches [254633] (16 species)
    not a true protein
  7. 2372928Species Amycolatopsis orientalis [TaxId:31958] [255630] (4 PDB entries)
  8. 2372935Domain d2vzta2: 2vzt A:226-335 [243977]
    Other proteins in same PDB: d2vzta1, d2vzta3, d2vztb1, d2vztb3
    automated match to d2vzsa1
    complexed with act, cd, pnj

Details for d2vzta2

PDB Entry: 2vzt (more details), 2.2 Å

PDB Description: complex of amycolatopsis orientalis exo-chitosanase csxa e541a with pnp-beta-d-glucosamine
PDB Compounds: (A:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2vzta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vzta2 b.1.4.0 (A:226-335) automated matches {Amycolatopsis orientalis [TaxId: 31958]}
avalrsahviqklnsaldhadltvkadvrndsanavqttvagtvagkpisqtvslaaker
ktvtfplvgldrpnvwwpagmggqhrydldltasvggtpsdaakskfgvr

SCOPe Domain Coordinates for d2vzta2:

Click to download the PDB-style file with coordinates for d2vzta2.
(The format of our PDB-style files is described here.)

Timeline for d2vzta2: