| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
| Protein automated matches [254633] (19 species) not a true protein |
| Species Amycolatopsis orientalis [TaxId:31958] [255630] (4 PDB entries) |
| Domain d2vzta2: 2vzt A:226-335 [243977] Other proteins in same PDB: d2vzta1, d2vzta3, d2vztb1, d2vztb3 automated match to d2vzsa1 complexed with act, cd, pnj |
PDB Entry: 2vzt (more details), 2.2 Å
SCOPe Domain Sequences for d2vzta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vzta2 b.1.4.0 (A:226-335) automated matches {Amycolatopsis orientalis [TaxId: 31958]}
avalrsahviqklnsaldhadltvkadvrndsanavqttvagtvagkpisqtvslaaker
ktvtfplvgldrpnvwwpagmggqhrydldltasvggtpsdaakskfgvr
Timeline for d2vzta2: