Lineage for d1dyub1 (1dyu B:301-725)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109071Fold b.30: Supersandwich [49993] (4 superfamilies)
  4. 109200Superfamily b.30.2: Copper amine oxidase, domain 3 (catalytic) [49998] (1 family) (S)
  5. 109201Family b.30.2.1: Copper amine oxidase, domain 3 (catalytic) [49999] (1 protein)
  6. 109202Protein Copper amine oxidase, domain 3 (catalytic) [50000] (4 species)
  7. 109207Species Escherichia coli [TaxId:562] [50001] (10 PDB entries)
  8. 109215Domain d1dyub1: 1dyu B:301-725 [24397]
    Other proteins in same PDB: d1dyua2, d1dyua3, d1dyua4, d1dyub2, d1dyub3, d1dyub4

Details for d1dyub1

PDB Entry: 1dyu (more details), 2.04 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase: x-ray crystallographic studies with mutational variants.

SCOP Domain Sequences for d1dyub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dyub1 b.30.2.1 (B:301-725) Copper amine oxidase, domain 3 (catalytic) {Escherichia coli}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnadyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galkk

SCOP Domain Coordinates for d1dyub1:

Click to download the PDB-style file with coordinates for d1dyub1.
(The format of our PDB-style files is described here.)

Timeline for d1dyub1: