Lineage for d2vzna1 (2vzn A:2-212)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577754Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 2577755Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 2577787Family d.111.1.0: automated matches [227200] (1 protein)
    not a true family
  6. 2577788Protein automated matches [226929] (4 species)
    not a true protein
  7. 2577805Species Red fire ant (Solenopsis invicta) [TaxId:13686] [255632] (1 PDB entry)
  8. 2577806Domain d2vzna1: 2vzn A:2-212 [243964]
    Other proteins in same PDB: d2vzna2, d2vznb2
    automated match to d1qnxa_

Details for d2vzna1

PDB Entry: 2vzn (more details), 3.05 Å

PDB Description: crystal structure of the major allergen from fire ant venom, sol i 3
PDB Compounds: (A:) venom allergen 3

SCOPe Domain Sequences for d2vzna1:

Sequence, based on SEQRES records: (download)

>d2vzna1 d.111.1.0 (A:2-212) automated matches {Red fire ant (Solenopsis invicta) [TaxId: 13686]}
nycnlqsckrnnaihtmcqytsptpgpmcleysnvgftdaekdaivnkhnelrqrvasgk
emrgtngpqppavkmpnltwdpelatiaqrwanqctfehdacrnverfavgqniaatsss
gknkstpnemillwynevkdfdnrwissfpsddnilmkvghytqivwakttkigcgrimf
kepdnwtkhylvcnygpagnvlgapiyeikk

Sequence, based on observed residues (ATOM records): (download)

>d2vzna1 d.111.1.0 (A:2-212) automated matches {Red fire ant (Solenopsis invicta) [TaxId: 13686]}
nycnlqsckrnnaihtmcqytsptpgpmcleysnvgftdaekdaivnkhnelrqrvasgk
emrgtngpqppavkmpnltwdpelatiaqrwanqctfehdacrnverfavgqniaatsss
gnkstpnemillwynevkdfdnrwissfpsddnilmkvghytqivwakttkigcgrimfk
epdnwtkhylvcnygpagnvlgapiyeikk

SCOPe Domain Coordinates for d2vzna1:

Click to download the PDB-style file with coordinates for d2vzna1.
(The format of our PDB-style files is described here.)

Timeline for d2vzna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vzna2