Lineage for d1dyua1 (1dyu A:301-724)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1534928Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1534929Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 1534930Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 1534931Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 1534997Species Escherichia coli [TaxId:562] [50001] (16 PDB entries)
  8. 1535004Domain d1dyua1: 1dyu A:301-724 [24396]
    Other proteins in same PDB: d1dyua2, d1dyua3, d1dyua4, d1dyub2, d1dyub3, d1dyub4
    complexed with ca, cu; mutant

Details for d1dyua1

PDB Entry: 1dyu (more details), 2.04 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase: x-ray crystallographic studies with mutational variants.
PDB Compounds: (A:) copper amine oxidase

SCOPe Domain Sequences for d1dyua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dyua1 b.30.2.1 (A:301-724) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galk

SCOPe Domain Coordinates for d1dyua1:

Click to download the PDB-style file with coordinates for d1dyua1.
(The format of our PDB-style files is described here.)

Timeline for d1dyua1: