Lineage for d1dyua1 (1dyu A:301-724)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58106Fold b.30: Supersandwich [49993] (4 superfamilies)
  4. 58155Superfamily b.30.2: Copper amine oxidase, domain 3 (catalytic) [49998] (1 family) (S)
  5. 58156Family b.30.2.1: Copper amine oxidase, domain 3 (catalytic) [49999] (1 protein)
  6. 58157Protein Copper amine oxidase, domain 3 (catalytic) [50000] (4 species)
  7. 58162Species Escherichia coli [TaxId:562] [50001] (9 PDB entries)
  8. 58169Domain d1dyua1: 1dyu A:301-724 [24396]
    Other proteins in same PDB: d1dyua2, d1dyua3, d1dyua4, d1dyub2, d1dyub3, d1dyub4

Details for d1dyua1

PDB Entry: 1dyu (more details), 2.04 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase: x-ray crystallographic studies with mutational variants.

SCOP Domain Sequences for d1dyua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dyua1 b.30.2.1 (A:301-724) Copper amine oxidase, domain 3 (catalytic) {Escherichia coli}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnadyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galk

SCOP Domain Coordinates for d1dyua1:

Click to download the PDB-style file with coordinates for d1dyua1.
(The format of our PDB-style files is described here.)

Timeline for d1dyua1: