Lineage for d2vz5a1 (2vz5 A:13-128)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048811Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2048812Protein automated matches [190436] (8 species)
    not a true protein
  7. 2048826Species Human (Homo sapiens) [TaxId:9606] [187333] (97 PDB entries)
  8. 2048886Domain d2vz5a1: 2vz5 A:13-128 [243958]
    Other proteins in same PDB: d2vz5a2
    automated match to d3dj1b_
    complexed with cl, imd, zn

Details for d2vz5a1

PDB Entry: 2vz5 (more details), 1.74 Å

PDB Description: structure of the pdz domain of tax1 (human t-cell leukemia virus type i) binding protein 3
PDB Compounds: (A:) tax1-binding protein 3

SCOPe Domain Sequences for d2vz5a1:

Sequence, based on SEQRES records: (download)

>d2vz5a1 b.36.1.0 (A:13-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaeiaglq
igdkimqvngwdmtmvthdqarkrltkrseevvrllvtrqslqkavqqsmlsetev

Sequence, based on observed residues (ATOM records): (download)

>d2vz5a1 b.36.1.0 (A:13-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaeiaglq
igdkimqvngwdmtmvthdqarkrltkrseevvrllvtrqssmlsetev

SCOPe Domain Coordinates for d2vz5a1:

Click to download the PDB-style file with coordinates for d2vz5a1.
(The format of our PDB-style files is described here.)

Timeline for d2vz5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vz5a2