Lineage for d2vxea_ (2vxe A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1786638Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1786639Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1787167Family b.38.1.5: LSM14 N-terminal domain-like [141297] (2 proteins)
    automatically mapped to Pfam PF14438
    automatically mapped to Pfam PF12701
  6. 1787171Protein automated matches [254634] (2 species)
    not a true protein
  7. 1787172Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255626] (1 PDB entry)
  8. 1787173Domain d2vxea_: 2vxe A: [243953]
    automated match to d2vxfa1

Details for d2vxea_

PDB Entry: 2vxe (more details)

PDB Description: solution structure of the lsm domain of drosophila melanogaster tral (trailer hitch)
PDB Compounds: (A:) cg10686-pa

SCOPe Domain Sequences for d2vxea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxea_ b.38.1.5 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gamamsgglpelgskisliskadiryegrlytvdpqectialssvrsfgtedrdtqfqia
pqsqiydyilfrgsdikdirvvnnhtlp

SCOPe Domain Coordinates for d2vxea_:

Click to download the PDB-style file with coordinates for d2vxea_.
(The format of our PDB-style files is described here.)

Timeline for d2vxea_: