Class b: All beta proteins [48724] (176 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.5: LSM14 N-terminal domain-like [141297] (2 proteins) automatically mapped to Pfam PF14438 automatically mapped to Pfam PF12701 |
Protein automated matches [254634] (2 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255626] (1 PDB entry) |
Domain d2vxea_: 2vxe A: [243953] automated match to d2vxfa1 |
PDB Entry: 2vxe (more details)
SCOPe Domain Sequences for d2vxea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vxea_ b.38.1.5 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} gamamsgglpelgskisliskadiryegrlytvdpqectialssvrsfgtedrdtqfqia pqsqiydyilfrgsdikdirvvnnhtlp
Timeline for d2vxea_: