![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
![]() | Protein automated matches [190036] (60 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255624] (13 PDB entries) |
![]() | Domain d2vuxb_: 2vux B: [243952] automated match to d2o1za_ complexed with fe |
PDB Entry: 2vux (more details), 2.8 Å
SCOPe Domain Sequences for d2vuxb_:
Sequence, based on SEQRES records: (download)
>d2vuxb_ a.25.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eepllrkssrrfvifpiqypdiwkmykqaqasfwtaeevdlskdlphwnklkadekyfis hilaffaasdgivnenlverfsqevqvpearcfygfqilienvhsemysllidtyirdpk kreflfnaietmpyvkkkadwalrwiadrkstfgervvafaavegvffsgsfaaifwlkk rglmpgltfsnelisrdeglhcdfaclmfqylvnkpseervreiivdavkieqeflteal pvgligmncilmkqyiefvadrllvelgfskvfqaenpfdfmen
>d2vuxb_ a.25.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eepllrkrfvifpiqypdiwkmykqaqasfwtaeevdlskdlphwnklkadekyfishil affanenlverfsqevqvpearcfygfqilienvhsemysllidtyirdpkkrpyvkkka dwtfgervvafaavegvffsgsfaaifwlkkrglmpgltfsnelisrdeglhcdfaclmf qylvnkpseervreiivdavkieqefltealpvgligmncilmkqyiefvadrllvelgf skvfqaenpfdfmen
Timeline for d2vuxb_: