Lineage for d2vuxa_ (2vux A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990537Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1990538Protein automated matches [190036] (38 species)
    not a true protein
  7. 1990622Species Human (Homo sapiens) [TaxId:9606] [255624] (7 PDB entries)
  8. 1990624Domain d2vuxa_: 2vux A: [243951]
    automated match to d2o1za_
    complexed with fe

Details for d2vuxa_

PDB Entry: 2vux (more details), 2.8 Å

PDB Description: human ribonucleotide reductase, subunit m2 b
PDB Compounds: (A:) ribonucleoside-diphosphate reductase subunit m2 b

SCOPe Domain Sequences for d2vuxa_:

Sequence, based on SEQRES records: (download)

>d2vuxa_ a.25.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
neepllrkssrrfvifpiqypdiwkmykqaqasfwtaeevdlskdlphwnklkadekyfi
shilaffaasdgivnenlverfsqevqvpearcfygfqilienvhsemysllidtyirdp
kkreflfnaietmpyvkkkadwalrwiadrkstfgervvafaavegvffsgsfaaifwlk
krglmpgltfsnelisrdeglhcdfaclmfqylvnkpseervreiivdavkieqefltea
lpvgligmncilmkqyiefvadrllvelgfskvfqaenpfdfm

Sequence, based on observed residues (ATOM records): (download)

>d2vuxa_ a.25.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
neepllrkvifpiqypdiwkmykqaqasfwtaeevdlskdlphwnklkadekyfishila
ffaasnlverfsqevqvpearcfygfqilienvhsemysllidtyirdpkkreflfnaie
tmpyvkkkadwalrwiadrkstfgervvafaavegvffsgsfaaifwlkkrglmpgltfs
nelisrdeglhcdfaclmfqylvnkpseervreiivdavkieqefltealpvgligmnci
lmkqyiefvadrllvelgfskvfqaenpfdfm

SCOPe Domain Coordinates for d2vuxa_:

Click to download the PDB-style file with coordinates for d2vuxa_.
(The format of our PDB-style files is described here.)

Timeline for d2vuxa_: