Lineage for d1d6zb1 (1d6z B:301-725)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2052444Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2052445Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 2052446Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 2052447Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 2052513Species Escherichia coli [TaxId:562] [50001] (16 PDB entries)
  8. 2052519Domain d1d6zb1: 1d6z B:301-725 [24395]
    Other proteins in same PDB: d1d6za2, d1d6za3, d1d6za4, d1d6zb2, d1d6zb3, d1d6zb4
    complexed with ca, cu, gol, hy1, pea, peo

Details for d1d6zb1

PDB Entry: 1d6z (more details), 2.1 Å

PDB Description: crystal structure of the aerobically freeze trapped rate-determining catalytic intermediate of e. coli copper-containing amine oxidase.
PDB Compounds: (B:) copper amine oxidase

SCOPe Domain Sequences for d1d6zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6zb1 b.30.2.1 (B:301-725) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galkk

SCOPe Domain Coordinates for d1d6zb1:

Click to download the PDB-style file with coordinates for d1d6zb1.
(The format of our PDB-style files is described here.)

Timeline for d1d6zb1: