Lineage for d2vufb1 (2vuf B:5-196)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009789Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2009790Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2010124Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2010125Protein automated matches [254493] (6 species)
    not a true protein
  7. 2010170Species Human (Homo sapiens) [TaxId:9606] [255068] (15 PDB entries)
  8. 2010207Domain d2vufb1: 2vuf B:5-196 [243948]
    automated match to d3jrya1
    complexed with fua

Details for d2vufb1

PDB Entry: 2vuf (more details), 3.05 Å

PDB Description: human serum albumin complexed with fusidic acid
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d2vufb1:

Sequence, based on SEQRES records: (download)

>d2vufb1 a.126.1.0 (B:5-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencdk
slhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvmc
tafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpklde
lrdegkassakq

Sequence, based on observed residues (ATOM records): (download)

>d2vufb1 a.126.1.0 (B:5-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencdk
slhtlfgdklctvaadccakqepernecflqhkddnpnlprlvrpevdvmctafhdneet
flkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkldelrdegkass
akq

SCOPe Domain Coordinates for d2vufb1:

Click to download the PDB-style file with coordinates for d2vufb1.
(The format of our PDB-style files is described here.)

Timeline for d2vufb1: