Class b: All beta proteins [48724] (180 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) automatically mapped to Pfam PF01179 |
Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins) |
Protein Copper amine oxidase, domain 3 [50000] (4 species) |
Species Escherichia coli [TaxId:562] [50001] (16 PDB entries) |
Domain d1d6za1: 1d6z A:301-724 [24394] Other proteins in same PDB: d1d6za2, d1d6za3, d1d6za4, d1d6zb2, d1d6zb3, d1d6zb4 complexed with ca, cu, gol, hy1, pea, peo |
PDB Entry: 1d6z (more details), 2.1 Å
SCOPe Domain Sequences for d1d6za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d6za1 b.30.2.1 (A:301-724) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]} pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl galk
Timeline for d1d6za1:
View in 3D Domains from other chains: (mouse over for more information) d1d6zb1, d1d6zb2, d1d6zb3, d1d6zb4 |