Lineage for d2vtda1 (2vtd A:1-93)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2110359Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 2110360Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 2110383Family c.5.1.0: automated matches [254240] (1 protein)
    not a true family
  6. 2110384Protein automated matches [254548] (5 species)
    not a true protein
  7. 2110385Species Escherichia coli [TaxId:562] [255257] (8 PDB entries)
  8. 2110390Domain d2vtda1: 2vtd A:1-93 [243939]
    Other proteins in same PDB: d2vtda2, d2vtda3, d2vtda4
    automated match to d4uaga1
    complexed with lkm, so4

Details for d2vtda1

PDB Entry: 2vtd (more details), 1.94 Å

PDB Description: crystal structure of murd ligase in complex with d-glu containing sulfonamide inhibitor
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2vtda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vtda1 c.5.1.0 (A:1-93) automated matches {Escherichia coli [TaxId: 562]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

SCOPe Domain Coordinates for d2vtda1:

Click to download the PDB-style file with coordinates for d2vtda1.
(The format of our PDB-style files is described here.)

Timeline for d2vtda1: