Lineage for d2vsnb2 (2vsn B:193-568)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142519Family c.87.1.12: O-GlcNAc transferase, OGT [254190] (1 protein)
    Pfam PF13844; PubMed 18536723
  6. 2142520Protein O-GlcNAc transferase, OGT [254419] (1 species)
  7. 2142521Species Xanthomonas campestris [TaxId:314565] [254862] (1 PDB entry)
  8. 2142523Domain d2vsnb2: 2vsn B:193-568 [243938]
    Other proteins in same PDB: d2vsna1, d2vsnb1
    complexed with udp

Details for d2vsnb2

PDB Entry: 2vsn (more details), 2.75 Å

PDB Description: structure and topological arrangement of an o-glcnac transferase homolog: insight into molecular control of intracellular glycosylation
PDB Compounds: (B:) xcogt

SCOPe Domain Sequences for d2vsnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vsnb2 c.87.1.12 (B:193-568) O-GlcNAc transferase, OGT {Xanthomonas campestris [TaxId: 314565]}
rplaptrvrskgplrvgfvsngfgahptglltvalfealqrrqpdlqmhlfatsgddgst
lrtrlaqastlhdvtalghlatakhirhhgidllfdlagwggggrpevfalrpapvqvnw
laypgtsgapwmdyvlgdafalppalepfysehvlrlqgafqpsdtsrvvaeppsrtqcg
lpeqgvvlccfnnsyklnpqsmarmlavlrevpdsvlwllsgpgeadarlrafahaqgvd
aqrlvfmpklphpqylaryrhadlfldthpynahttasdalwtgcpvlttpgetfaarva
gslnhhlgldemnvaddaafvakavalasdpaaltalharvdvlrrasgvfhmdgfaddf
gallqalarrhgwlgi

SCOPe Domain Coordinates for d2vsnb2:

Click to download the PDB-style file with coordinates for d2vsnb2.
(The format of our PDB-style files is described here.)

Timeline for d2vsnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vsnb1