Lineage for d2vsna1 (2vsn A:22-192)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2010681Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2010682Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2010765Protein O-GlcNAc transferase, OGT [109973] (2 species)
  7. 2010769Species Xanthomonas campestris [TaxId:314565] [254861] (1 PDB entry)
  8. 2010770Domain d2vsna1: 2vsn A:22-192 [243935]
    Other proteins in same PDB: d2vsna2, d2vsnb2
    complexed with udp

Details for d2vsna1

PDB Entry: 2vsn (more details), 2.75 Å

PDB Description: structure and topological arrangement of an o-glcnac transferase homolog: insight into molecular control of intracellular glycosylation
PDB Compounds: (A:) xcogt

SCOPe Domain Sequences for d2vsna1:

Sequence, based on SEQRES records: (download)

>d2vsna1 a.118.8.1 (A:22-192) O-GlcNAc transferase, OGT {Xanthomonas campestris [TaxId: 314565]}
awlmladaelgmgdttagemavqrglalhpghpeavarlgrvrwtqqrhaeaavllqqas
daapehpgialwlghaledagqaeaaaaaytrahqllpeepyitaqllnwrrrlcdwral
dvlsaqvraavaqgvgavepfaflsedasaaeqlacartraqaiaasv

Sequence, based on observed residues (ATOM records): (download)

>d2vsna1 a.118.8.1 (A:22-192) O-GlcNAc transferase, OGT {Xanthomonas campestris [TaxId: 314565]}
awlmladaelgdttagemavqrpeavarlgrvrwtqqrhaeaavllqqasdaapehpgia
lwlghaledagqaeaaaaaytrahqllpeepyitaqllnwrrrlcdwraldvlsaqvraa
vaqgvgavepfaflsedasaaeqlacartraqaiaasv

SCOPe Domain Coordinates for d2vsna1:

Click to download the PDB-style file with coordinates for d2vsna1.
(The format of our PDB-style files is described here.)

Timeline for d2vsna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vsna2