Lineage for d2vs0b_ (2vs0 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2315669Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) (S)
    (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 2315683Family a.25.3.0: automated matches [193224] (1 protein)
    not a true family
  6. 2315684Protein automated matches [193225] (4 species)
    not a true protein
  7. 2315720Species Staphylococcus aureus [TaxId:1280] [255623] (2 PDB entries)
  8. 2315722Domain d2vs0b_: 2vs0 B: [243934]
    automated match to d3gvmc_
    complexed with cac, zn

Details for d2vs0b_

PDB Entry: 2vs0 (more details), 1.4 Å

PDB Description: structural analysis of homodimeric staphylococcal aureus virulence factor esxa
PDB Compounds: (B:) virulence factor esxa

SCOPe Domain Sequences for d2vs0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vs0b_ a.25.3.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ikmspeeiraksqsygqgsdqirqilsdltraqgeiaanwegqafsrfeeqfqqlspkve
kfaqlleeikqqlnstadavqeqd

SCOPe Domain Coordinates for d2vs0b_:

Click to download the PDB-style file with coordinates for d2vs0b_.
(The format of our PDB-style files is described here.)

Timeline for d2vs0b_: