SCOPe 2.08: Domain d2vs0b_: 2vs0 B:

Lineage for d2vs0b_ (2vs0 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.3: EsxAB dimer-like [140453] (2 families)
   (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals

5. Family a.25.3.0: automated matches [193224] (1 protein)
   not a true family

6. Protein automated matches [193225] (4 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [255623] (2 PDB entries)

8. Domain d2vs0b_: 2vs0 B: [243934]
   automated match to d3gvmc_
   complexed with cac, zn

Details for d2vs0b_

PDB Entry: 2vs0, 1.4 Å

PDB Description: structural analysis of homodimeric staphylococcal aureus virulence factor esxa

PDB Compounds: (B:) virulence factor esxa

SCOPe Domain Sequences for d2vs0b_:

Sequence; same for both SEQRES and ATOM records:

>d2vs0b_ a.25.3.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ikmspeeiraksqsygqgsdqirqilsdltraqgeiaanwegqafsrfeeqfqqlspkve
kfaqlleeikqqlnstadavqeqd

Timeline for d2vs0b_:

• d2vs0b_ first appeared in SCOPe 2.04
  
• d2vs0b_ appears in SCOPe 2.07