![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) ![]() (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals |
![]() | Family a.25.3.0: automated matches [193224] (1 protein) not a true family |
![]() | Protein automated matches [193225] (4 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [255623] (2 PDB entries) |
![]() | Domain d2vs0b_: 2vs0 B: [243934] automated match to d3gvmc_ complexed with cac, zn |
PDB Entry: 2vs0 (more details), 1.4 Å
SCOPe Domain Sequences for d2vs0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vs0b_ a.25.3.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} ikmspeeiraksqsygqgsdqirqilsdltraqgeiaanwegqafsrfeeqfqqlspkve kfaqlleeikqqlnstadavqeqd
Timeline for d2vs0b_: