Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals |
Family a.25.3.0: automated matches [193224] (1 protein) not a true family |
Protein automated matches [193225] (4 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [255623] (2 PDB entries) |
Domain d2vrzb_: 2vrz B: [243932] automated match to d3gvmc_ complexed with zn |
PDB Entry: 2vrz (more details), 1.9 Å
SCOPe Domain Sequences for d2vrzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vrzb_ a.25.3.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} ikmspeeiraksqsygqgsdqirqilsdltraqgeiaanwegqafsrfeeqfqqlspkve kfaqlleeikqqlnstadavqeqdq
Timeline for d2vrzb_: