Lineage for d2vrzb_ (2vrz B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2705332Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) (S)
    (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 2705346Family a.25.3.0: automated matches [193224] (1 protein)
    not a true family
  6. 2705347Protein automated matches [193225] (4 species)
    not a true protein
  7. 2705383Species Staphylococcus aureus [TaxId:1280] [255623] (2 PDB entries)
  8. 2705387Domain d2vrzb_: 2vrz B: [243932]
    automated match to d3gvmc_
    complexed with zn

Details for d2vrzb_

PDB Entry: 2vrz (more details), 1.9 Å

PDB Description: structural analysis of homodimeric staphylococcal aureus esxa
PDB Compounds: (B:) virulence factor esxa

SCOPe Domain Sequences for d2vrzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vrzb_ a.25.3.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ikmspeeiraksqsygqgsdqirqilsdltraqgeiaanwegqafsrfeeqfqqlspkve
kfaqlleeikqqlnstadavqeqdq

SCOPe Domain Coordinates for d2vrzb_:

Click to download the PDB-style file with coordinates for d2vrzb_.
(The format of our PDB-style files is described here.)

Timeline for d2vrzb_: