Lineage for d1qakb1 (1qak B:301-727)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309061Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1309062Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 1309063Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 1309064Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 1309130Species Escherichia coli [TaxId:562] [50001] (16 PDB entries)
  8. 1309134Domain d1qakb1: 1qak B:301-727 [24393]
    Other proteins in same PDB: d1qaka2, d1qaka3, d1qaka4, d1qakb2, d1qakb3, d1qakb4
    complexed with ca, cu; mutant

Details for d1qakb1

PDB Entry: 1qak (more details), 2 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase : x-ray crystallographic studies with mutational variants
PDB Compounds: (B:) copper amine oxidase

SCOPe Domain Sequences for d1qakb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qakb1 b.30.2.1 (B:301-727) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkaylasgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galkkdk

SCOPe Domain Coordinates for d1qakb1:

Click to download the PDB-style file with coordinates for d1qakb1.
(The format of our PDB-style files is described here.)

Timeline for d1qakb1: