Lineage for d1qakb1 (1qak B:301-727)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12903Fold b.30: Supersandwich [49993] (3 superfamilies)
  4. 12952Superfamily b.30.2: Copper amine oxidase, domain 3 (catalytic) [49998] (1 family) (S)
  5. 12953Family b.30.2.1: Copper amine oxidase, domain 3 (catalytic) [49999] (1 protein)
  6. 12954Protein Copper amine oxidase, domain 3 (catalytic) [50000] (4 species)
  7. 12959Species Escherichia coli [TaxId:562] [50001] (9 PDB entries)
  8. 12963Domain d1qakb1: 1qak B:301-727 [24393]
    Other proteins in same PDB: d1qaka2, d1qaka3, d1qaka4, d1qakb2, d1qakb3, d1qakb4

Details for d1qakb1

PDB Entry: 1qak (more details), 2 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase : x-ray crystallographic studies with mutational variants

SCOP Domain Sequences for d1qakb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qakb1 b.30.2.1 (B:301-727) Copper amine oxidase, domain 3 (catalytic) {Escherichia coli}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkaylasgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnadyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galkkdk

SCOP Domain Coordinates for d1qakb1:

Click to download the PDB-style file with coordinates for d1qakb1.
(The format of our PDB-style files is described here.)

Timeline for d1qakb1: