Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (38 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [255073] (2 PDB entries) |
Domain d2vqda2: 2vqd A:115-330 [243929] Other proteins in same PDB: d2vqda1, d2vqda3 automated match to d2w70a2 complexed with ap2, mg, so4 |
PDB Entry: 2vqd (more details), 2.41 Å
SCOPe Domain Sequences for d2vqda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqda2 d.142.1.0 (A:115-330) automated matches {Pseudomonas aeruginosa [TaxId: 287]} dkvsakdamkragvptvpgsdgplpedeetalaiarevgypviikaagggggrgmrvvyd eseliksakltrteagaafgnpmvylekfltnprhvevqvlsdgqgnaihlgdrdcslqr rhqkvieeapapgidekarqevfarcvqacieigyrgagtfeflyengrfyfiemntrvq vehpvsemvtgvdivkemlriasgeklsirqedvvi
Timeline for d2vqda2: