Lineage for d2vqda2 (2vqd A:115-330)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2585054Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2585055Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2585592Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2585593Protein automated matches [226904] (38 species)
    not a true protein
  7. 2585707Species Pseudomonas aeruginosa [TaxId:287] [255073] (2 PDB entries)
  8. 2585710Domain d2vqda2: 2vqd A:115-330 [243929]
    Other proteins in same PDB: d2vqda1, d2vqda3
    automated match to d2w70a2
    complexed with ap2, mg, so4

Details for d2vqda2

PDB Entry: 2vqd (more details), 2.41 Å

PDB Description: crystal structure of biotin carboxylase from pseudomonas aeruginosa complexed with ampcp
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d2vqda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqda2 d.142.1.0 (A:115-330) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dkvsakdamkragvptvpgsdgplpedeetalaiarevgypviikaagggggrgmrvvyd
eseliksakltrteagaafgnpmvylekfltnprhvevqvlsdgqgnaihlgdrdcslqr
rhqkvieeapapgidekarqevfarcvqacieigyrgagtfeflyengrfyfiemntrvq
vehpvsemvtgvdivkemlriasgeklsirqedvvi

SCOPe Domain Coordinates for d2vqda2:

Click to download the PDB-style file with coordinates for d2vqda2.
(The format of our PDB-style files is described here.)

Timeline for d2vqda2: