SCOPe 2.05: Domain d2vqda1: 2vqd A:1-114

Lineage for d2vqda1 (2vqd A:1-114)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (9 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (28 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [255072] (2 PDB entries)

8. Domain d2vqda1: 2vqd A:1-114 [243928]
   Other proteins in same PDB: d2vqda2, d2vqda3
   automated match to d2w70a1
   complexed with ap2, mg, so4

Details for d2vqda1

PDB Entry: 2vqd, 2.41 Å

PDB Description: crystal structure of biotin carboxylase from pseudomonas aeruginosa complexed with ampcp

PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d2vqda1:

Sequence; same for both SEQRES and ATOM records:

>d2vqda1 c.30.1.0 (A:1-114) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mlekvlianrgeialrilrackelgiktvavhstadrelmhlsladesvcigpapatqsy
lqipaiiaaaevtgataihpgygflaenadfaeqiersgftfvgptaevirlmg

Timeline for d2vqda1:

• d2vqda1 first appeared in SCOPe 2.04
  
• d2vqda1 appears in SCOPe 2.06
  
• d2vqda1 appears in the current release, SCOPe 2.08