![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
![]() | Protein automated matches [226903] (40 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [255072] (2 PDB entries) |
![]() | Domain d2vqda1: 2vqd A:1-114 [243928] Other proteins in same PDB: d2vqda2, d2vqda3 automated match to d2w70a1 complexed with ap2, mg, so4 |
PDB Entry: 2vqd (more details), 2.41 Å
SCOPe Domain Sequences for d2vqda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqda1 c.30.1.0 (A:1-114) automated matches {Pseudomonas aeruginosa [TaxId: 287]} mlekvlianrgeialrilrackelgiktvavhstadrelmhlsladesvcigpapatqsy lqipaiiaaaevtgataihpgygflaenadfaeqiersgftfvgptaevirlmg
Timeline for d2vqda1: