Lineage for d2vp8b_ (2vp8 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089689Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2089825Family c.1.21.0: automated matches [191656] (1 protein)
    not a true family
  6. 2089826Protein automated matches [191224] (3 species)
    not a true protein
  7. 2089838Species Mycobacterium tuberculosis [TaxId:83332] [255617] (1 PDB entry)
  8. 2089840Domain d2vp8b_: 2vp8 B: [243919]
    automated match to d3tyzb_
    complexed with edo

Details for d2vp8b_

PDB Entry: 2vp8 (more details), 2.64 Å

PDB Description: structure of mycobacterium tuberculosis rv1207
PDB Compounds: (B:) dihydropteroate synthase 2

SCOPe Domain Sequences for d2vp8b_:

Sequence, based on SEQRES records: (download)

>d2vp8b_ c.1.21.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
hstlcgrpvagdralimaivnrtpdsfydkgatfsdaaardavhravadgadvidvggvk
agpgervdvdteitrlvpfiewlrgaypdqlisvdtwraqvakaacaagadlindtwggv
dpampevaaefgaglvcahtggalprtrpfrvsygtttrgvvdavisqvtaaaeravaag
varekvlidpahdfgkntfhgllllrhvadlvmtgwpvlmalsnkdvvgetlgvdlterl
egtlaatalaaaagarmfrvhevaatrrvlemvasiqgvrpp

Sequence, based on observed residues (ATOM records): (download)

>d2vp8b_ c.1.21.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
hstlcgrpvagdralimaivnrtdaaardavhravadgadvidvggvdvdteitrlvpfi
ewlrgaypdqlisvdtwraqvakaacaagadlindtwggvdpampevaaefgaglvcaht
ygtttrgvvdavisqvtaaaeravaagvarekvlidpahdfgkntfhgllllrhvadlvm
tgwpvlmalsnerlegtlaatalaaaagarmfrvhevaatrrvlemvasiqgvrpp

SCOPe Domain Coordinates for d2vp8b_:

Click to download the PDB-style file with coordinates for d2vp8b_.
(The format of our PDB-style files is described here.)

Timeline for d2vp8b_: