Lineage for d2vk8b3 (2vk8 B:361-563)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592643Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1592644Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. Protein automated matches [227126] (15 species)
    not a true protein
  7. 1593265Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255615] (3 PDB entries)
  8. 1593269Domain d2vk8b3: 2vk8 B:361-563 [243911]
    Other proteins in same PDB: d2vk8a2, d2vk8b2, d2vk8c2, d2vk8d2
    automated match to d1qpba3
    complexed with 2op, mg, tpp

Details for d2vk8b3

PDB Entry: 2vk8 (more details), 1.42 Å

PDB Description: crystal structure of the saccharomyces cerevisiae pyruvate decarboxylase variant e477q in complex with its substrate
PDB Compounds: (B:) pyruvate decarboxylase isozyme 1

SCOPe Domain Sequences for d2vk8b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vk8b3 c.36.1.0 (B:361-563) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
astplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttg
atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytiqkli
hgpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmievml
pvfdapqnlveqakltaatnakq

SCOPe Domain Coordinates for d2vk8b3:

Click to download the PDB-style file with coordinates for d2vk8b3.
(The format of our PDB-style files is described here.)

Timeline for d2vk8b3: