Lineage for d1oacb1 (1oac B:301-727)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391116Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 2391117Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins)
  6. 2391118Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 2391184Species Escherichia coli [TaxId:562] [50001] (16 PDB entries)
  8. 2391186Domain d1oacb1: 1oac B:301-727 [24391]
    Other proteins in same PDB: d1oaca2, d1oaca3, d1oaca4, d1oacb2, d1oacb3, d1oacb4
    complexed with ca, cu

Details for d1oacb1

PDB Entry: 1oac (more details), 2 Å

PDB Description: crystal structure of a quinoenzyme: copper amine oxidase of escherichia coli at 2 angstroems resolution
PDB Compounds: (B:) copper amine oxidase

SCOPe Domain Sequences for d1oacb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oacb1 b.30.2.1 (B:301-727) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galkkdk

SCOPe Domain Coordinates for d1oacb1:

Click to download the PDB-style file with coordinates for d1oacb1.
(The format of our PDB-style files is described here.)

Timeline for d1oacb1: