![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
![]() | Protein automated matches [190312] (14 species) not a true protein |
![]() | Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [255612] (3 PDB entries) |
![]() | Domain d2vk4d2: 2vk4 D:182-360 [243904] Other proteins in same PDB: d2vk4a1, d2vk4a3, d2vk4b1, d2vk4b3, d2vk4c1, d2vk4c3, d2vk4d1, d2vk4d3 automated match to d1qpba1 complexed with mg, tpp |
PDB Entry: 2vk4 (more details), 1.95 Å
SCOPe Domain Sequences for d2vk4d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vk4d2 c.31.1.0 (D:182-360) automated matches {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]} dtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfp afvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsysy ktknivefhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneava
Timeline for d2vk4d2: