Lineage for d1oaca1 (1oac A:301-724)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109071Fold b.30: Supersandwich [49993] (4 superfamilies)
  4. 109200Superfamily b.30.2: Copper amine oxidase, domain 3 (catalytic) [49998] (1 family) (S)
  5. 109201Family b.30.2.1: Copper amine oxidase, domain 3 (catalytic) [49999] (1 protein)
  6. 109202Protein Copper amine oxidase, domain 3 (catalytic) [50000] (4 species)
  7. 109207Species Escherichia coli [TaxId:562] [50001] (10 PDB entries)
  8. 109208Domain d1oaca1: 1oac A:301-724 [24390]
    Other proteins in same PDB: d1oaca2, d1oaca3, d1oaca4, d1oacb2, d1oacb3, d1oacb4

Details for d1oaca1

PDB Entry: 1oac (more details), 2 Å

PDB Description: crystal structure of a quinoenzyme: copper amine oxidase of escherichia coli at 2 angstroems resolution

SCOP Domain Sequences for d1oaca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oaca1 b.30.2.1 (A:301-724) Copper amine oxidase, domain 3 (catalytic) {Escherichia coli}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnadyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galk

SCOP Domain Coordinates for d1oaca1:

Click to download the PDB-style file with coordinates for d1oaca1.
(The format of our PDB-style files is described here.)

Timeline for d1oaca1: